PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29929.m004641
Common NameLOC8286787, RCOM_1079880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 483aa    MW: 52963.9 Da    PI: 8.5456
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29929.m004641genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.31.6e-41187264178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +CqvegC+ dls+ak+yhr+h+vCe hsk+p+v+v+gle+rfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk+q+
  29929.m004641 187 RCQVEGCNLDLSSAKDYHRKHRVCENHSKCPKVIVAGLERRFCQQCSRFHGLSEFDEKKRSCRRRLSDHNARRRKPQP 264
                    6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-34180249IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.06185262IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-39186267IPR004333Transcription factor, SBP-box
PfamPF031102.4E-31188261IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MSSLSLMEWN TKPPIQWDWE NLIMFNTTTE NPKKLRVTEW EIDGEKGIDS GSIYSSGSGS  60
GSGSGGSGSD LGLASLSKSS KSASINSSSI GEVKTSNFTF EASEATEDFN NKKAFTAKPT  120
GTSSTIEASV GSGEPLLGLK LGKRTYFEDV CAGSNIKSSS FSSAIPGSSI SPPKRSKSSS  180
QASSTPRCQV EGCNLDLSSA KDYHRKHRVC ENHSKCPKVI VAGLERRFCQ QCSRFHGLSE  240
FDEKKRSCRR RLSDHNARRR KPQPESIQMN SARLSSSSYD ERPHMSLVWN RAPLVHARAN  300
ANLAWEGTSS SKFTITKEYV LKPAKIGGID GQLHLPANEL TTSIPLHPHN CKSLLPSKAK  360
VPIAEVLNQD LEESIISSNV DATQDLHRAL SLLSTNSWGS CEPKSFSHER PAQLSHTGMP  420
QSVLHAVPQG LPLTSSDYWR AEQHITNSRV HTLTSQNDSS SYFQEFQLLR APYDNDFYSS  480
QLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-28179261284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243260KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572189.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_015572190.10.0PREDICTED: squamosa promoter-binding-like protein 2
SwissprotQ9S8401e-100SPL2_ARATH; Squamosa promoter-binding-like protein 2
TrEMBLB9RMD60.0B9RMD6_RICCO; LIGULELESS1 protein, putative
STRINGPOPTR_0003s17120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-86squamosa promoter binding protein-like 2